PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00040.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 314aa    MW: 35471.6 Da    PI: 8.2416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00040.1_g00005.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.7e-181461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT+eEd +l+ +++++G g+W++ +++ g++R++k+c++rw +yl
  Rsa1.0_00040.1_g00005.1 14 KGPWTPEEDHKLLAYIEEHGHGSWRSLPEKAGLHRCGKSCRLRWTNYL 61
                             79********************************************97 PP

2Myb_DNA-binding513.4e-1667112148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++  +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
  Rsa1.0_00040.1_g00005.1  67 RGKFNLQEEQTIIQLHALLGNR-WSAIATHLP-KRTDNEIKNYWNTHL 112
                              899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-25563IPR009057Homeodomain-like
PROSITE profilePS5129418.152961IPR017930Myb domain
SuperFamilySSF466892.42E-3011108IPR009057Homeodomain-like
SMARTSM007172.8E-141363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001673.60E-101661No hitNo description
PROSITE profilePS5129425.2562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-2664117IPR009057Homeodomain-like
SMARTSM007173.9E-1666114IPR001005SANT/Myb domain
PfamPF002492.4E-1567112IPR001005SANT/Myb domain
CDDcd001671.38E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MGRSPCCDKL GLKKGPWTPE EDHKLLAYIE EHGHGSWRSL PEKAGLHRCG KSCRLRWTNY  60
LRPDIKRGKF NLQEEQTIIQ LHALLGNRWS AIATHLPKRT DNEIKNYWNT HLKKRLVKMG  120
IDPVTHKRKN ETPLGLSKNA ATLSHMAQWE SARLEAEARL ARESKLLHYQ TKASSHHGFT  180
RKTWTTKTNQ GNADQQQQLE SPTSTVSFSD MKEQSTAKME FTGSSSTGLA LVKEPENDWI  240
STTIFEGVEE GFTGLLLGGD TLGRSFSADK NERDHGENSG GGECNNYFED NKNYLDSIFN  300
FVDPPPSSDS QPIF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3533460.0AK353346.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-35-F01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121584.10.0PREDICTED: myb-related protein Hv1
TrEMBLM4CWV80.0M4CWV8_BRARP; Uncharacterized protein
STRINGBra008705.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-152myb domain protein 16